PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr2P22510_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family GRAS
Protein Properties Length: 260aa    MW: 27416.9 Da    PI: 5.6236
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr2P22510_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS49.57.6e-16162220159
                   GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvse 59 
                            lv++L++cAeav++++l++a+al++++  l +++g +m+++a yf+eALa+r++r +++
  GSMUA_Achr2P22510_001 162 LVHALMACAEAVQQESLKAADALVKQITVLTTSQGGAMRKVAGYFAEALARRIYRPQPH 220
                            689****************************************************5554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011292.2E-301996No hitNo description
PfamPF120412.0E-351990IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098511.926136260IPR005202Transcription factor GRAS
PfamPF035142.6E-13162220IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEHEKGKDTM GAEEDGGVDE LLAALGYKVR SSDMADVAQK LEQLEKAMGS STAANDDALF  60
SHLASDTVHY NPSDIFTWVD NILSELNAPP TPLAPPPPPP PPALPIVYGS DAQSVLAPSP  120
RDRKRLKVCS SPPSSSSTTD AAKSDKALPV VVVDTQEAGI RLVHALMACA EAVQQESLKA  180
ADALVKQITV LTTSQGGAMR KVAGYFAEAL ARRIYRPQPH RGVGCSSQDS AALDNILHDC  240
SGQPSFRPSP SAPVARPRSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2zsh_B2e-2510891591DELLA protein GAI
2zsi_B2e-2510891591DELLA protein GAI
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1530423e-95DQ153042.1 Musa AAB Group GRAS transcription factor (GAI1) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009390245.11e-140PREDICTED: DELLA protein SLR1-like
SwissprotQ9SLH36e-61RGA_ARATH; DELLA protein RGA
TrEMBLM0SA920.0M0SA92_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr2P22510_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP99838138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.16e-52GRAS family protein